PDB entry 1ezj

View 1ezj on RCSB PDB site
Description: crystal structure of the multimerization domain of the phosphoprotein from sendai virus
Class: Viral protein, transferase
Keywords: Four stranded coiled coil, viral polymerase, Sendai virus, tetramer, Viral protein, transferase
Deposited on 2000-05-11, released 2000-09-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.249
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleocapsid phosphoprotein
    Species: Sendai virus (strain Harris) [TaxId:11196]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ezja_
  • Heterogens: EMC, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ezjA (A:)
mentssmkematlltslgviqsaqefessrdasyvfarralksanyaemtfnvcglilsa
ekssarkvdenkqllkqiqesvesfrdiykrfseyqkeqnsllmsnlstlhiitd

    Sequence, based on observed residues (ATOM records): (download) 
    >1ezjA (A:)
entssmkematlltslgviqsaqefessrdasyvfarralksanyaemtfnvcglilsae
kssarkvdenkqllkqiqesvesfrdiykrfseyqkeqnsllmsnlstlhiitd