PDB entry 1ezi

View 1ezi on RCSB PDB site
Description: Structure of a sialic acid activating synthetase, CMP acylneuraminate synthetase in the presence and absence of CDP
Class: transferase
Keywords: homodimer, alpha-beta-alpha, transferase
Deposited on 2000-05-11, released 2001-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cmp-n-acetylneuraminic acid synthetase
    Species: Neisseria meningitidis [TaxId:487]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0Z8 (0-End)
      • conflict (0)
      • conflict (25)
      • conflict (135)
      • conflict (154)
      • conflict (201)
    Domains in SCOPe 2.07: d1ezia_
  • Chain 'B':
    Compound: cmp-n-acetylneuraminic acid synthetase
    Species: Neisseria meningitidis [TaxId:487]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0Z8 (0-End)
      • conflict (0)
      • conflict (25)
      • conflict (135)
      • conflict (154)
      • conflict (201)
    Domains in SCOPe 2.07: d1ezib_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eziA (A:)
    mekqniavilarqnskglplknlrkmngisllghtinaaisskcfdriivstdggliaee
    aknfgvevvlrpaelasdtassisgvihaletigsnsgtvtllqptsplrtgahireafs
    lfdekikgsvvsacpmehhplktllqinngeyapmrhlsdleqprqqlpqafrpngaiyi
    ndtaslianncffiaptklyimshqdsididteldlqqaenilnhkes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eziA (A:)
    mekqniavilarqnskglplknlrkmngisllghtinaaisskcfdriivstdggliaee
    aknfgvevvlrpaassisgvihaletigsnsgtvtllqptsplrtgahireafslfdeki
    kgsvvsacpmehhplktllqineyapmrhlsdleqprqqlpqafrpngaiyindtaslia
    nncffiaptklyimshqdsididteldlqqaeniln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eziB (B:)
    mekqniavilarqnskglplknlrkmngisllghtinaaisskcfdriivstdggliaee
    aknfgvevvlrpaelasdtassisgvihaletigsnsgtvtllqptsplrtgahireafs
    lfdekikgsvvsacpmehhplktllqinngeyapmrhlsdleqprqqlpqafrpngaiyi
    ndtaslianncffiaptklyimshqdsididteldlqqaenilnhkes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eziB (B:)
    mekqniavilarqnlplknlrkmngisllghtinaaisskcfdriivstdggliaeeakn
    fgvevvlrpaessisgvihaletigsnsgtvtllqptsplrtgahireafslfdekikgs
    vvsacpmehhplktllqinngeyapmrhlsdleqprqqlpqafrpngaiyindtaslian
    ncffiaptklyimshqdsididteldlqqaeni