PDB entry 1ezf

View 1ezf on RCSB PDB site
Description: crystal structure of human squalene synthase
Deposited on 2000-05-10, released 2000-10-18
The last revision prior to the SCOP 1.55 freeze date was dated 2000-10-18, with a file datestamp of 2000-10-18.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.213
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ezfa_
  • Chain 'B':
    Domains in SCOP 1.55: d1ezfb_
  • Chain 'C':
    Domains in SCOP 1.55: d1ezfc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ezfA (A:)
    nslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisvekkvpll
    hnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrmgigmaef
    ldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglflqktnii
    rdyledqqggrefwpqevwsryvkklgdfakpenidlavqclnelitnalhhipdvityl
    srlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavkirkgqavtlmmdatnmpavkai
    iyqymeeiyhripdsdpsssktrqiistirtqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ezfA (A:)
    nslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisvekkvpll
    hnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrmgigmaef
    ldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglflqktnii
    rdyledqqggrefwpqevwsryvkklgdfakpenidlavqclnelitnalhhipdvityl
    srlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavkidatnmpavkaiiyqymeeiyh
    ripdsdpsssktrqiistirtqn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ezfB (B:)
    nslsnslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisvekk
    vpllhnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrmgig
    maefldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglflqk
    tniirdyledqqggrefwpqevwsryvkklgdfakpenidlavqclnelitnalhhipdv
    itylsrlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavkirkgqavtlmmdatnmpa
    vkaiiyqymeeiyhripdsdpsssktrqiistirtqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ezfB (B:)
    nslsnslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisvekk
    vpllhnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrmgig
    maefldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglflqk
    tniirdyledqqggrefwpqevwsryvkklgdfakpenidlavqclnelitnalhhipdv
    itylsrlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavatnmpavkaiiyqymeeiy
    hripdsdpsssktrqiistirtqn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ezfC (C:)
    nslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisvekkvpll
    hnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrmgigmaef
    ldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglflqktnii
    rdyledqqggrefwpqevwsryvkklgdfakpenidlavqclnelitnalhhipdvityl
    srlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavkirkgqavtlmmdatnmpavkai
    iyqymeeiyhripdsdpsssktrqiistirtqn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ezfC (C:)
    nslktcykylnqtsrsfaaviqaldgemrnavcifylvlraldtleddmtisvekkvpll
    hnfhsflyqpdwrfmeskekdrqvledfptislefrnlaekyqtviadicrrmgigmaef
    ldkhvtseqewdkychyvaglvgiglsrlfsasefedplvgedteransmglflqktnii
    rdyledqqggrefwpqevwsryvkklgdfakpenidlavqclnelitnalhhipdvityl
    srlrnqsvfnfcaipqvmaiatlaacynnqqvfkgavatnmpavkaiiyqymeeiyhrip
    dsdpsssktrqiistirtqn