PDB entry 1eze

View 1eze on RCSB PDB site
Description: structural studies of a baboon (papio sp.) plasma protein inhibitor of cholesteryl ester transferase.
Class: transferase inhibitor
Keywords: amphipathic helix, TRANSFERASE INHIBITOR
Deposited on 2000-05-10, released 2000-09-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cholesteryl ester transferase inhibitor protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ezea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ezeA (A:)
    apdvssaldklkefgntledkawevinrikqsefpakt