PDB entry 1ezc

View 1ezc on RCSB PDB site
Description: amino terminal domain of enzyme I from escherichia coli, nmr, 17 structures
Class: phosphotransferase
Keywords: phosphotransferase, kinase, sugar transport
Deposited on 1997-01-01, released 1998-01-07
The last revision prior to the SCOP 1.75 freeze date was dated 1998-01-07, with a file datestamp of 2007-06-04.
Experiment type: NMR17
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enzyme I
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ezca1, d1ezca2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ezcA (A:)
    misgilaspgiafgkalllkedeividrkkisadqvdqeverflsgrakasaqletiktk
    agetfgeekeaifeghimlledeeleqeiialikdkhmtadaaaheviegqasaleeldd
    eylkeraadvrdigkrllrnilglkiidlsaiqdevilvaadltpsetaqlnlkkvlgfi
    tdaggrtshtsimarslelpaivgtgsvtsqvknddylildavnnqvyvnptnevidkmr
    avqeqvasekaelaklkdr