PDB entry 1ez8

View 1ez8 on RCSB PDB site
Description: structure of s. nuclease stabilizing mutant t33v
Class: hydrolase
Keywords: hydrolase
Deposited on 2000-05-10, released 2000-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.197
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: staphylococcal nuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered (32)
    Domains in SCOPe 2.07: d1ez8a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ez8A (A:)
    atstkklhkepatlikaidgdtvklmykgqpmvfrlllvdtpetkhpkkgvekygpeasa
    ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
    heqhlrkseaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ez8A (A:)
    lhkepatlikaidgdtvklmykgqpmvfrlllvdtpetkhpkkgvekygpeasaftkkmv
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlr
    kseaqakkeklniws