PDB entry 1ez6

View 1ez6 on RCSB PDB site
Description: structure of s. nuclease stabilizing sextuple mutant t33v/t41i/s59a/p117g/h124l/s128a
Deposited on 2000-05-10, released 2000-10-18
The last revision prior to the SCOP 1.57 freeze date was dated 2000-10-18, with a file datestamp of 2000-10-18.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1ez6a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ez6A (A:)
  lhkepatlikaidgdtvklmykgqpmvfrlllvdipetkhpkkgvekygpeaaaftkkmv
  enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
  kaeaqakkeklniws