PDB entry 1ez3

View 1ez3 on RCSB PDB site
Description: crystal structure of the neuronal t-snare syntaxin-1a
Class: endocytosis/exocytosis
Keywords: three helix bundle, endocytosis/exocytosis complex
Deposited on 2000-05-09, released 2000-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.231
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: syntaxin-1a
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ez3a_
  • Chain 'B':
    Compound: syntaxin-1a
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ez3b_
  • Chain 'C':
    Compound: syntaxin-1a
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ez3c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ez3A (A:)
    vdrdrfmdeffeqveeirgfidkiaenveevkrkhsailaspnpdektkeeleelmsdik
    ktankvrsklksieqsieqeeglnrssadlrirktqhstlsrkfvevmseynatqsdyre
    rckgriq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ez3A (A:)
    rdrfmdeffeqveeirgfidkiaenveevkrkhsailaspnpdektkeeleelmsdikkt
    ankvrsklksieqsieqeeglnrssadlrirktqhstlsrkfvevmseynatqsdyrerc
    kgri
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ez3B (B:)
    vdrdrfmdeffeqveeirgfidkiaenveevkrkhsailaspnpdektkeeleelmsdik
    ktankvrsklksieqsieqeeglnrssadlrirktqhstlsrkfvevmseynatqsdyre
    rckgriq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ez3B (B:)
    drfmdeffeqveeirgfidkiaenveevkrkhsailaspnpdektkeeleelmsdikkta
    nkvrsklksieqsieqeeglnrssadlrirktqhstlsrkfvevmseynatqsdyrerck
    griq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ez3C (C:)
    vdrdrfmdeffeqveeirgfidkiaenveevkrkhsailaspnpdektkeeleelmsdik
    ktankvrsklksieqsieqeeglnrssadlrirktqhstlsrkfvevmseynatqsdyre
    rckgriq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ez3C (C:)
    rdrfmdeffeqveeirgfidkiaenveevkrkhsailaspnpdektkeeleelmsdikkt
    ankvrsklksieqsieqeeglnrssadlrirktqhstlsrkfvevmseynatqsdyrerc
    kgri