PDB entry 1ez1

View 1ez1 on RCSB PDB site
Description: structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg, amppnp, and gar
Deposited on 2000-05-09, released 2000-08-02
The last revision prior to the SCOP 1.57 freeze date was dated 2000-11-29, with a file datestamp of 2000-11-29.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.189
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ez1A (A:)
    tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
    ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltmnregirrla
    aeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsaeqlaqawkya
    qqggragagrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqmsp
    laleraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlsefa
    lhvraflglpvggirqygpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgs
    rrlgvalataesvvdaierakhaagqvkvqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ez1A (A:)
    tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
    ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltmnregirrla
    aeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsaeqlaqawkya
    qqggragrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqmspla
    leraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlsefalh
    vraflglpvggirqygpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgsrr
    lgvalataesvvdaierakhaagqvkvqg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ez1B (B:)
    tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
    ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltmnregirrla
    aeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsaeqlaqawkya
    qqggragagrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqmsp
    laleraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlsefa
    lhvraflglpvggirqygpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgs
    rrlgvalataesvvdaierakhaagqvkvqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ez1B (B:)
    tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
    ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltmnregirrla
    aeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsaeqlaqawkya
    qqggragrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqmspla
    leraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlsefalh
    vraflglpvggirqygpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgsrr
    lgvalataesvvdaierakhaagqvkvqg