PDB entry 1eyz

View 1eyz on RCSB PDB site
Description: structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg and amppnp
Class: transferase
Keywords: Transformylase, purine biosynthesis, ATP-grasp, TRANSFERASE
Deposited on 2000-05-09, released 2000-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoribosylglycinamide formyltransferase 2
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eyza1, d1eyza2, d1eyza3
  • Chain 'B':
    Compound: phosphoribosylglycinamide formyltransferase 2
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eyzb1, d1eyzb2, d1eyzb3
  • Heterogens: MG, NA, CL, ANP, MPO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eyzA (A:)
    mtllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvin
    mldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltmnregirrl
    aaeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsaeqlaqawky
    aqqggragagrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqms
    plaleraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlsef
    alhvraflglpvggirqygpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidg
    srrlgvalataesvvdaierakhaagqvkvqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eyzA (A:)
    tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
    ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltmnregirrla
    aeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsaeqlaqawkya
    qqggragrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqmspla
    leraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlsefalh
    vraflglpvggirqygpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgsrr
    lgvalataesvvdaierakhaagqvkvqg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eyzB (B:)
    mtllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvin
    mldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltmnregirrl
    aaeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsaeqlaqawky
    aqqggragagrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqms
    plaleraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlsef
    alhvraflglpvggirqygpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidg
    srrlgvalataesvvdaierakhaagqvkvqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eyzB (B:)
    tllgtalrpaatrvmllgsgelgkevaiecqrlgveviavdryadapamhvahrshvinm
    ldgdalrrvvelekphyivpeieaiatdmliqleeeglnvvpcaratkltmnregirrla
    aeelqlptstyrfadseslfreavadigypcivkpvmsssgkgqtfirsaeqlaqawkya
    qqggragrvivegvvkfdfeitlltvsavdgvhfcapvghrqedgdyreswqpqqmspla
    leraqeiarkvvlalggyglfgvelfvcgdevifsevsprphdtgmvtlisqdlsefalh
    vraflglpvggirqygpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgsrr
    lgvalataesvvdaierakhaagqvkvqg