PDB entry 1eyv

View 1eyv on RCSB PDB site
Description: the crystal structure of nusb from mycobacterium tuberculosis
Class: transcription
Keywords: helical bundle, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, TRANSCRIPTION
Deposited on 2000-05-09, released 2000-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.19
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: n-utilizing substance protein b homolog
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eyva_
  • Chain 'B':
    Compound: n-utilizing substance protein b homolog
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eyvb_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eyvA (A:)
    msdrkpvrgrhqarkravallfeaevrgisaaevvdtraalaeakpdiarlhpytaavar
    gvsehaahiddlitahlrgwtldrlpavdrailrvsvwellhaadvpepvvvdeavqlak
    elstddspgfvngvlgqvmlvtpqlraaaqavrgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eyvA (A:)
    grhqarkravallfeaevrgisaaevvdtraalaeakpdiarlhpytaavargvsehaah
    iddlitahlrgwtldrlpavdrailrvsvwellhaadvpepvvvdeavqlakelstddsp
    gfvngvlgqvm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eyvB (B:)
    msdrkpvrgrhqarkravallfeaevrgisaaevvdtraalaeakpdiarlhpytaavar
    gvsehaahiddlitahlrgwtldrlpavdrailrvsvwellhaadvpepvvvdeavqlak
    elstddspgfvngvlgqvmlvtpqlraaaqavrgga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eyvB (B:)
    vrgrhqarkravallfeaevrgisaaevvdtraalaeakpdiarlhpytaavargvseha
    ahiddlitahlrgwtldrlpavdrailrvsvwellhaadvpepvvvdeavqlakelstdd
    spgfvngvlgqvm