PDB entry 1eyu

View 1eyu on RCSB PDB site
Description: high resolution structure of the pvuii endonculease/cognate DNA complex at ph 4.6
Class: hydrolase/DNA
Keywords: PROTEIN-DNA COMPLEX, endonuclease type II, restriction enzyme, hydrolase/DNA COMPLEX
Deposited on 2000-05-09, released 2000-07-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.208
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: type II restriction enzyme pvuii
    Species: Proteus vulgaris [TaxId:585]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1eyua_
  • Chain 'B':
    Compound: type II restriction enzyme pvuii
    Species: Proteus vulgaris [TaxId:585]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1eyub_
  • Chain 'C':
    Compound: DNA (5'-d(*tp*gp*ap*cp*cp*ap*gp*cp*tp*gp*gp*tp*c)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*tp*gp*ap*cp*cp*ap*gp*cp*tp*gp*gp*tp*c)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eyuA (A:)
    mshpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndav
    dnagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdl
    efyydkwerkwysdghkdinnpkipvkyvmehgtkiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eyuA (A:)
    shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd
    nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
    fyydkwerkwysdghkdinnpkipvkyvmehgtkiy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eyuB (B:)
    mshpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndav
    dnagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdl
    efyydkwerkwysdghkdinnpkipvkyvmehgtkiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eyuB (B:)
    shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgndavdnag
    qeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdlefyy
    dkwerkwysdghkdinnpkipvkyvmehgtkiy
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.