PDB entry 1eyu

View 1eyu on RCSB PDB site
Description: high resolution structure of the pvuii endonculease/cognate dna complex at ph 4.6
Deposited on 2000-05-09, released 2000-07-21
The last revision prior to the SCOP 1.55 freeze date was dated 2000-07-21, with a file datestamp of 2000-07-21.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.208
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1eyua_
  • Chain 'B':
    Domains in SCOP 1.55: d1eyub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eyuA (A:)
    shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd
    nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
    fyydkwerkwysdghkdinnpkipvkyvmehgtkiy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eyuB (B:)
    shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgregndavd
    nagqeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdle
    fyydkwerkwysdghkdinnpkipvkyvmehgtkiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eyuB (B:)
    shpdlnkllelwphiqeyqdlalkhgindifqdnggkllqvllitgltvlpgndavdnag
    qeyelksinidltkgfsthhhmnpviiakyrqvpwifaiyrgiaieaiyrlepkdlefyy
    dkwerkwysdghkdinnpkipvkyvmehgtkiy