PDB entry 1eyt

View 1eyt on RCSB PDB site
Description: crystal structure of high-potential iron-sulfur protein from thermochromatium tepidum
Class: electron transport
Keywords: Iron-sulfur protein, ELECTRON TRANSPORT
Deposited on 2000-05-08, released 2000-12-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.212
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: high-potential iron-sulfur protein
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1eyta_
  • Heterogens: SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eytA (A:)
    aapanavtaddptaialkynqdatkservaaarpglppeeqhcancqfmqanvgegdwkg
    cqlfpgklinvngwcaswtlkag