PDB entry 1eyo

View 1eyo on RCSB PDB site
Description: solution structure of conotoxin tviia from conus tulipa
Deposited on 2000-05-07, released 2000-09-06
The last revision prior to the SCOP 1.65 freeze date was dated 2000-09-06, with a file datestamp of 2000-09-06.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1eyoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eyoA (A:)
    scsgrdsrcppvccmglmcsrgkcvsiyge