PDB entry 1eyo

View 1eyo on RCSB PDB site
Description: solution structure of conotoxin tviia from conus tulipa
Class: toxin
Keywords: cystine knot motif, TOXIN
Deposited on 2000-05-07, released 2000-09-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conotoxin tviia
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1eyoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eyoA (A:)
    scsgrdsrcppvccmglmcsrgkcvsiyge