PDB entry 1eyn

View 1eyn on RCSB PDB site
Description: Structure of mura liganded with the extrinsic fluorescence probe ANS
Class: transferase
Keywords: inside-out alpha-beta barrel; L-isoaspartate in position 67, TRANSFERASE
Deposited on 2000-05-07, released 2000-06-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.18
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-N-acetylglucosamine 1-carboxyvinyltransferase
    Species: Enterobacter cloacae [TaxId:550]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33038 (0-418)
      • engineered (66)
    Domains in SCOPe 2.08: d1eyna_
  • Heterogens: 2AN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eynA (A:)
    mdkfrvqgptrlqgevtisgaknaalpilfaallaeepveiqnvpklkdidttmklltql
    gtkverdgsvwidasnvnnfsapydlvktmrasiwalgplvarfgqgqvslpggcaigar
    pvdlhifgleklgaeikleegyvkasvngrlkgahivmdkvsvgatvtimsaatlaegtt
    iienaarepeivdtanflvalgakisgqgtdritiegverlgggvyrvlpdrietgtflv
    aaaisggkivcrnaqpdtldavlaklreagadietgedwisldmhgkrpkavtvrtaphp
    afptdmqaqftllnlvaegtgvitetifenrfmhvpelirmgahaeiesntvichgvekl
    sgaqvmatdlrasaslvlagciaegttvvdriyhidrgyeriedklralganiervkge