PDB entry 1eym

View 1eym on RCSB PDB site
Description: fk506 binding protein mutant, homodimeric complex
Class: isomerase
Keywords: rotamase; isomerase; ligand-reversible dimer, isomerase
Deposited on 2000-05-07, released 2000-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fk506 binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62942 (0-106)
      • engineered (35)
    Domains in SCOPe 2.07: d1eyma_
  • Chain 'B':
    Compound: fk506 binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62942 (0-106)
      • engineered (35)
    Domains in SCOPe 2.07: d1eymb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eymA (A:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkmdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eymB (B:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkmdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle