PDB entry 1eym

View 1eym on RCSB PDB site
Description: fk506 binding protein mutant, homodimeric complex
Class: isomerase
Keywords: rotamase; isomerase; ligand-reversible dimer, isomerase
Deposited on 2000-05-07, released 2000-08-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: fk506 binding protein
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62942 (0-106)
    • engineered (35)
  Domains in SCOPe 2.08: d1eyma_
• Chain 'B':
  Compound: fk506 binding protein
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62942 (0-106)
    • engineered (35)
  Domains in SCOPe 2.08: d1eymb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eymA (A:)
  gvqvetispgdgrtfpkrgqtcvvhytgmledgkkmdssrdrnkpfkfmlgkqevirgwe
  egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eymB (B:)
  gvqvetispgdgrtfpkrgqtcvvhytgmledgkkmdssrdrnkpfkfmlgkqevirgwe
  egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle