PDB entry 1eyl

View 1eyl on RCSB PDB site
Description: structure of a recombinant winged bean chymotrypsin inhibitor
Class: hydrolase inhibitor
Keywords: beta trefoil, hydrolase inhibitor
Deposited on 2000-05-07, released 2000-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.233
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chymotrypsin inhibitor
    Species: Psophocarpus tetragonolobus [TaxId:3891]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10822 (3-End)
      • expression artifact (1-2)
    Domains in SCOPe 2.07: d1eyla_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eylA (A:)
    mefdddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskgep
    irissqflslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvf
    kfekvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkaks
    etassh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eylA (A:)
    efdddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskgepi
    rissqflslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfk
    fekvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkaks