PDB entry 1eyj

View 1eyj on RCSB PDB site
Description: fructose-1,6-bisphosphatase complex with amp, magnesium, fructose-6-phosphate and phosphate (t-state)
Class: hydrolase
Keywords: bisphosphatase, allosteric enzymes, gluconeogenesis, hydrolase
Deposited on 2000-05-07, released 2000-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fructose-1,6-bisphosphatase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eyja_
  • Chain 'B':
    Compound: fructose-1,6-bisphosphatase
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eyjb_
  • Heterogens: F6P, MG, PO4, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eyjA (A:)
    tdqaafdtnivtltrfvmeegrkargtgemtqllnslctavkaistavrkagiahlygia
    gstnvtgdqvkkldvlsndlvinvlkssfatcvlvseedknaiivepekrgkyvvcfdpl
    dgssnidclvsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvng
    vncfmldpaigefilvdrdvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapy
    garyvgsmvadvhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgke
    avldivptdihqrapiilgspedvtelleiyqkhaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eyjA (A:)
    nivtltrfvmeegrkargtgemtqllnslctavkaistavrkagiahlygiagstnvtgd
    qvkkldvlsndlvinvlkssfatcvlvseedknaiivepekrgkyvvcfdpldgssnidc
    lvsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvngvncfmldp
    aigefilvdrdvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapygaryvgsm
    vadvhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgkeavldivpt
    dihqrapiilgspedvtelleiyqkha
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eyjB (B:)
    tdqaafdtnivtltrfvmeegrkargtgemtqllnslctavkaistavrkagiahlygia
    gstnvtgdqvkkldvlsndlvinvlkssfatcvlvseedknaiivepekrgkyvvcfdpl
    dgssnidclvsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvng
    vncfmldpaigefilvdrdvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapy
    garyvgsmvadvhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgke
    avldivptdihqrapiilgspedvtelleiyqkhaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eyjB (B:)
    nivtltrfvmeegrkargtgemtqllnslctavkaistavrkagiahlygiagstnvtgd
    qvkkldvlsndlvinvlkssfatcvlvseedknaiivepekrgkyvvcfdpldgssnidc
    lvsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvngvncfmldp
    aigefilvdrdvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapygaryvgsm
    vadvhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgkeavldivpt
    dihqrapiilgspedvtelleiyqkha