PDB entry 1eyh

View 1eyh on RCSB PDB site
Description: crystal structure of the epsin n-terminal homology (enth) domain at 1.56 angstrom resolution
Class: cell cycle
Keywords: superhelix of helices, cell cycle
Deposited on 2000-05-06, released 2000-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.199
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epsin
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eyha_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eyhA (A:)
    hnyseaeikvreatsndpwgpssslmseiadltynvvafseimsmiwkrlndhgknwrhv
    ykamtlmeyliktgservsqqckenmyavqtlkdfqyvdrdgkdqgvnvrekakqlvall
    rdedrlreerahalktkeklaqta