PDB entry 1eyh

View 1eyh on RCSB PDB site
Description: crystal structure of the epsin n-terminal homology (enth) domain at 1.56 angstrom resolution
Deposited on 2000-05-06, released 2000-06-07
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-07, with a file datestamp of 2000-06-07.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.201
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1eyha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eyhA (A:)
    hnyseaeikvreatsndpwgpssslmseiadltynvvafseimsmiwkrlndhgknwrhv
    ykamtlmeyliktgservsqqckenmyavqtlkdfqyvdrdgkdqgvnvrekakqlvall
    rdedrlreerahalktkeklaqta