PDB entry 1eyh

View 1eyh on RCSB PDB site
Description: crystal structure of the epsin n-terminal homology (enth) domain at 1.56 angstrom resolution
Class: cell cycle
Keywords: superhelix of helices, cell cycle
Deposited on 2000-05-06, released 2000-06-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: epsin
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O88339 (0-143)
  Domains in SCOPe 2.08: d1eyha_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1eyhA (A:)
  hnyseaeikvreatsndpwgpssslmseiadltynvvafseimsmiwkrlndhgknwrhv
  ykamtlmeyliktgservsqqckenmyavqtlkdfqyvdrdgkdqgvnvrekakqlvall
  rdedrlreerahalktkeklaqta