PDB entry 1eyg

View 1eyg on RCSB PDB site
Description: Crystal structure of chymotryptic fragment of E. coli ssb bound to two 35-mer single strand DNAS
Class: replication/DNA
Keywords: PROTEIN-DNA COMPLEX; OB fold; Se-Met; MAD PHASING; SSB; binding mode, replication/DNA COMPLEX
Deposited on 2000-05-06, released 2000-08-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.256
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: single-strand DNA-binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1eyga_
  • Chain 'B':
    Compound: single-strand DNA-binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1eygb_
  • Chain 'C':
    Compound: single-strand DNA-binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1eygc_
  • Chain 'D':
    Compound: single-strand DNA-binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1eygd_
  • Chain 'Q':
    Compound: single stranded 28-mer of d(c)
  • Chain 'R':
    Compound: single stranded 28-mer of d(c)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eygA (A:)
    masrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvl
    fgklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eygA (A:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eygB (B:)
    masrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvl
    fgklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eygB (B:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatsesweqtewhrvvlfgklaevase
    ylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1eygC (C:)
    masrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvl
    fgklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eygC (C:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqml
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1eygD (D:)
    masrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvl
    fgklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eygD (D:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkamkeqtewhrvvlfgkl
    aevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggr
    

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.