PDB entry 1eyg

View 1eyg on RCSB PDB site
Description: Crystal structure of chymotryptic fragment of E. coli ssb bound to two 35-mer single strand DNAS
Deposited on 2000-05-06, released 2000-08-01
The last revision prior to the SCOP 1.67 freeze date was dated 2000-08-21, with a file datestamp of 2000-08-21.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.256
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1eyga_
  • Chain 'B':
    Domains in SCOP 1.67: d1eygb_
  • Chain 'C':
    Domains in SCOP 1.67: d1eygc_
  • Chain 'D':
    Domains in SCOP 1.67: d1eygd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eygA (A:)
    masrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvl
    fgklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eygA (A:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1eygB (B:)
    masrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvl
    fgklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eygB (B:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatsesweqtewhrvvlfgklaevase
    ylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1eygC (C:)
    masrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvl
    fgklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eygC (C:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
    gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqml
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1eygD (D:)
    masrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvl
    fgklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eygD (D:)
    asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkamkeqtewhrvvlfgkl
    aevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlggr