PDB entry 1eyf

View 1eyf on RCSB PDB site
Description: refined structure of the DNA methyl phosphotriester repair domain of e. coli ada
Class: DNA binding protein
Keywords: One central beta-sheet sandwiched between two alpha-helices, DNA BINDING PROTEIN
Deposited on 2000-05-06, released 2003-09-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ada regulatory protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1eyfa_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1eyfA (A:)
mkkatcltddqrwqsvlardpnadgefvfavrttgifcrpscrarhalrenvsfyanase
alaagfrpckrcqpdkanprqhrldkithacr