PDB entry 1eye

View 1eye on RCSB PDB site
Description: 1.7 angstrom resolution crystal structure of 6-hydroxymethyl-7,8-dihydropteroate synthase (dhps) from mycobacterium tuberculosis in complex with 6-hydroxymethylpterin monophosphate
Class: transferase
Keywords: alpha-beta barrel, TRANSFERASE
Deposited on 2000-05-05, released 2000-10-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.185
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydropteroate synthase I
    Species: Mycobacterium tuberculosis H37Rv [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1eyea_
  • Heterogens: MG, PMM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eyeA (A:)
    mspapvqvmgvlnvtddsfsdggcyldlddavkhglamaaagagivdvggessrpgatrv
    dpavetsrvipvvkelaaqgitvsidtmradvaraalqngaqmvndvsggradpamgpll
    aeadvpwvlmhwravsadtphvpvrygnvvaevradllasvadavaagvdparlvldpgl
    gfaktaqhnwailhalpelvatgipvlvgasrkrflgallagpdgvmrptdgrdtatavi
    salaalhgawgvrvhdvrasvdaikvveawmgaerierdg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eyeA (A:)
    pvqvmgvlnvtddsfsdggcyldlddavkhglamaaagagivdvggetsrvipvvkelaa
    qgitvsidtmradvaraalqngaqmvndvsggradpamgpllaeadvpwvlmhwravsad
    tphvpvrygnvvaevradllasvadavaagvdparlvldpglgfaktaqhnwailhalpe
    lvatgipvlvgasrkrflgallagpdgvmrptdgrdtatavisalaalhgawgvrvhdvr
    asvdaikvveawmgae