PDB entry 1eye

View 1eye on RCSB PDB site
Description: 1.7 angstrom resolution crystal structure of 6-hydroxymethyl-7,8- dihydropteroate synthase (dhps) from mycobacterium tuberculosis in complex with 6-hydroxymethylpterin monophosphate
Deposited on 2000-05-05, released 2000-10-11
The last revision prior to the SCOP 1.55 freeze date was dated 2000-10-11, with a file datestamp of 2000-10-11.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.185
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1eyea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eyeA (A:)
    pvqvmgvlnvtddsfsdggcyldlddavkhglamaaagagivdvggessrpgatrvdpav
    etsrvipvvkelaaqgitvsidtmradvaraalqngaqmvndvsggradpamgpllaead
    vpwvlmhwravsadtphvpvrygnvvaevradllasvadavaagvdparlvldpglgfak
    taqhnwailhalpelvatgipvlvgasrkrflgallagpdgvmrptdgrdtatavisala
    alhgawgvrvhdvrasvdaikvveawmgae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eyeA (A:)
    pvqvmgvlnvtddsfsdggcyldlddavkhglamaaagagivdvggetsrvipvvkelaa
    qgitvsidtmradvaraalqngaqmvndvsggradpamgpllaeadvpwvlmhwravsad
    tphvpvrygnvvaevradllasvadavaagvdparlvldpglgfaktaqhnwailhalpe
    lvatgipvlvgasrkrflgallagpdgvmrptdgrdtatavisalaalhgawgvrvhdvr
    asvdaikvveawmgae