PDB entry 1eyb

View 1eyb on RCSB PDB site
Description: crystal structure of apo human homogentisate dioxygenase
Class: oxidoreductase
Keywords: jelly roll, beta sandwich, OXIDOREDUCTASE
Deposited on 2000-05-05, released 2000-11-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-06-24, with a file datestamp of 2015-06-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: homogentisate 1,2-dioxygenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93099
      • engineered (167)
      • engineered (197)
      • engineered (211)
      • engineered (308)
      • engineered (364)
      • engineered (368)
      • engineered (393)
      • engineered (421)
      • engineered (424)
    Domains in SCOPe 2.07: d1eyba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1eybA (A:)
    mghhhhhhhhhhssghiddddkhmgsmaelkyisgfgnecssedprcpgslpegqnnpqv
    cpynlyaeqlsgsaftcprstnkrswlyrilpsvshkpfesideghvthnwdevdpdpnq
    lrwkpfeipkasqkkvdfvsglhtlcgagdiksnnglaihiflcntsmenrcfynsdgdf
    livpqkgnlliytefgkmlvqpneicviqrgmrfsidvfeetrgyilevygvhfelpdlg
    piganglanprdflipiawyedrqvpggytvinkyqgklfaakqdvspfnvvawhgnytp
    ykynlknfmvinsvafdhadpsiftvltaksvrpgvaiadfvifpprwgvadktfrppyy
    hrncmsefmglirghyeakqggflpgggslhstmtphgpdadcfekaskvklaperiadg
    tmafmfesslslavtkwglkasrcldenyhkcweplkshftpnsrnpaepn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eybA (A:)
    aelkyisgfgnecssedprcpgslpegqnnpqvcpynlyaeqlsgsaftcprstnkrswl
    yrilpsvshkpfesideghvthnwdevdpdpnqlrwkpfeipkasqkkvdfvsglhtlcg
    agdiksnnglaihiflcntsmenrcfynsdgdflivpqkgnlliytefgkmlvqpneicv
    iqrgmrfsidvfeetrgyilevygvhfelpdlgpiganglanprdflipiawyedrqvpg
    gytvinkyqgklfaakqdvspfnvvawhgnytpykynlknfmvinsvafdhadpsiftvl
    taksvrpgvaiadfvifpprwgvadktfrppyyhrncmsefmglirgflpgggslhstmt
    phgpdadcfekaskvklaperiadgtmafmfesslslavtkwglkasrlkshftpnsrn