PDB entry 1ey9

View 1ey9 on RCSB PDB site
Description: structure of s. nuclease stabilizing quadruple mutant t41i/p117g/h124l/s128a
Deposited on 2000-05-05, released 2000-10-18
The last revision prior to the SCOP 1.57 freeze date was dated 2000-10-18, with a file datestamp of 2000-10-18.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.205
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1ey9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ey9A (A:)
lhkepatlikaidgdtvklmykgqpmtfrlllvdipetkhpkkgvekygpeasaftkkmv
enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllr
kaeaqakkeklniws