PDB entry 1ey1

View 1ey1 on RCSB PDB site
Description: solution structure of escherichia coli nusb
Deposited on 2000-05-05, released 2000-06-14
The last revision prior to the SCOP 1.69 freeze date was dated 2000-06-14, with a file datestamp of 2000-06-14.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ey1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ey1A (A:)
mkpaarrrarecavqalyswqlsqndiadveyqflaeqdvkdvdvlyfrellagvatnta
yldglmkpylsrlleelgqvekavlrialyelskrsdvpykvaineaielaksfgaedsh
kfvngvldkaapvirpnkk