PDB entry 1ey1

View 1ey1 on RCSB PDB site
Description: solution structure of escherichia coli nusb
Class: transcription
Keywords: transcirption termination, transcription
Deposited on 2000-05-05, released 2000-06-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: antitermination factor nusb
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A780 (0-138)
  Domains in SCOPe 2.08: d1ey1a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ey1A (A:)
  mkpaarrrarecavqalyswqlsqndiadveyqflaeqdvkdvdvlyfrellagvatnta
  yldglmkpylsrlleelgqvekavlrialyelskrsdvpykvaineaielaksfgaedsh
  kfvngvldkaapvirpnkk