PDB entry 1ey1

View 1ey1 on RCSB PDB site
Description: solution structure of escherichia coli nusb
Class: transcription
Keywords: transcirption termination, transcription
Deposited on 2000-05-05, released 2000-06-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antitermination factor nusb
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ey1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ey1A (A:)
    mkpaarrrarecavqalyswqlsqndiadveyqflaeqdvkdvdvlyfrellagvatnta
    yldglmkpylsrlleelgqvekavlrialyelskrsdvpykvaineaielaksfgaedsh
    kfvngvldkaapvirpnkk