PDB entry 1exz

View 1exz on RCSB PDB site
Description: structure of stem cell factor
Class: hormone/growth factor
Keywords: scf, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2000-05-05, released 2000-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.223
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: stem cell factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1exza_
  • Chain 'B':
    Compound: stem cell factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1exzb_
  • Chain 'C':
    Compound: stem cell factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1exzc_
  • Chain 'D':
    Compound: stem cell factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1exzd_
  • Heterogens: SM, CA, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1exzA (A:)
    egicrnrvtnnvkdvtklvanlpkdymitlkyvpgmdvlpshcwisemvvqlsdsltdll
    dkfsniseglsnysiidklvnivddlvecvkensskdlkksfkspeprlftpeeffrifn
    rsidafkdfvvasetsdcvvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1exzA (A:)
    crnrvtnnvkdvtklvanlpkdymitlkyvpgmdvlpshcwisemvvqlsdsltdlldkf
    sniseglsnysiidklvnivddlvecvkensskdlkksfkspeprlftpeeffrifnrsi
    dafkdfvvasdcv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1exzB (B:)
    egicrnrvtnnvkdvtklvanlpkdymitlkyvpgmdvlpshcwisemvvqlsdsltdll
    dkfsniseglsnysiidklvnivddlvecvkensskdlkksfkspeprlftpeeffrifn
    rsidafkdfvvasetsdcvvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1exzB (B:)
    gicrnrvtnnvkdvtklvanlpkdymitlkyvpgmdvlpshcwisemvvqlsdsltdlld
    kfsniseglsnysiidklvnivddlvecvkensskdlkksfkspeprlftpeeffrifnr
    sidafkdfvvasetsdcvvs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1exzC (C:)
    egicrnrvtnnvkdvtklvanlpkdymitlkyvpgmdvlpshcwisemvvqlsdsltdll
    dkfsniseglsnysiidklvnivddlvecvkensskdlkksfkspeprlftpeeffrifn
    rsidafkdfvvasetsdcvvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1exzC (C:)
    tnnvkdvtklvanlpkdymitlkyvpgmdvlpshcwisemvvqlsdsltdlldkfsnise
    glsnysiidklvnivddlvecvkensskdlkksfkspeprlftpeeffrifnrsidafkd
    fvvasetsdcv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1exzD (D:)
    egicrnrvtnnvkdvtklvanlpkdymitlkyvpgmdvlpshcwisemvvqlsdsltdll
    dkfsniseglsnysiidklvnivddlvecvkensskdlkksfkspeprlftpeeffrifn
    rsidafkdfvvasetsdcvvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1exzD (D:)
    tnnvkdvtklvanlpkdymitlkyvpgmdvlpshcwisemvvqlsdsltdlldkfsnise
    glsnysiidklvnivddlvecvkensskdlkksfkspeprlftpeeffrifnrsidafkd
    fvva