PDB entry 1exw

View 1exw on RCSB PDB site
Description: crystal structure of palmitoyl protein thioesterase 1 complexed with hexadecylsulfonyl fluoride
Class: hydrolase
Keywords: alpha/beta hydrolase, palmitoyl protein thioesterase, PMSF, HYDROLASE
Deposited on 2000-05-04, released 2000-08-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: palmitoyl protein thioesterase 1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1exwa_
  • Heterogens: NAG, HDS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1exwA (A:)
dppaplplviwhgmgdsccnplsmgaikkmvekkipgihvlsleigktlredvensffln
vnsqvttvcqilakdpklqqgynamgfsqggqflravaqrcpsppmvnlisvggqhqgvf
glprcpgesshicdfirktlnagaynkaiqerlvqaeywhdpirediyrnhsifladinq
ergvnesykknlmalkkfvmvkflndtivdpvdsewfgfyrsgqaketiplqestlytqd
rlglkamdkagqlvflalegdhlqlseewfyahiipfle