PDB entry 1exv

View 1exv on RCSB PDB site
Description: human liver glycogen phosphorylase a complexed with glcnac and cp-403, 700
Deposited on 2000-05-04, released 2000-11-01
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-01, with a file datestamp of 2000-11-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.236
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1exva_
  • Chain 'B':
    Domains in SCOP 1.55: d1exvb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1exvA (A:)
    nvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkrv
    yylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaac
    fldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvhf
    ygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapndfnlrdfnvgdy
    iqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskfgstrga
    gtvfdafpdqvaiqlndthpalaipelmrifvdieklpwskaweltqktfaytnhtvlpe
    alerwpvdlvekllprhleiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinma
    hlcivgshavngvakihsdivktkvfkdfselepdkfqnktngitprrwlllcnpglael
    iaekigedyvkdlsqltklhsflgddvflrelakvkqenklkfsqfleteykvkinpssm
    fdvqvkriheykrqllnclhvitmynrikkdpkklfvprtviiggkaapgyhmakmiikl
    itsvadvvnndpmvgsklkviflenyrvslaekvipatdlseqistagteasgtgnmkfm
    lngaltigtmdganvemaeeageenlfifgmriddvaaldkkgyeakeyyealpelklvi
    dqidngffspkqpdlfkdiinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvl
    kniaasgkfssdrtikeyaqniwnveps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1exvA (A:)
    nvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkrv
    yylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaac
    fldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvhf
    ygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapgdyiqavldrnla
    enisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkafdafpdqvaiqlndthpal
    aipelmrifvdieklpwskaweltqktfaytnhtvlpealerwpvdlvekllprhleiiy
    einqkhldrivalfpkdvdrlrrmslieeegskrinmahlcivgshavngvakihsdivk
    tkvfkdfselepdkfqnktngitprrwlllcnpglaeliaekigedyvkdlsqltklhsf
    lgddvflrelakvkqenklkfsqfleteykvkinpssmfdvqvkriheykrqllnclhvi
    tmynrikkdpkklfvprtviiggkaapgyhmakmiiklitsvadvvnndpmvgsklkvif
    lenyrvslaekvipatdlseqistagteasgtgnmkfmlngaltigtmdganvemaeeag
    eenlfifgmriddvaaldkkgyeakeyyealpelklvidqidngffspkqpdlfkdiinm
    lfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikeyaqni
    wnveps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1exvB (B:)
    nvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkrv
    yylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaac
    fldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvhf
    ygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapndfnlrdfnvgdy
    iqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskfgstrga
    gtvfdafpdqvaiqlndthpalaipelmrifvdieklpwskaweltqktfaytnhtvlpe
    alerwpvdlvekllprhleiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinma
    hlcivgshavngvakihsdivktkvfkdfselepdkfqnktngitprrwlllcnpglael
    iaekigedyvkdlsqltklhsflgddvflrelakvkqenklkfsqfleteykvkinpssm
    fdvqvkriheykrqllnclhvitmynrikkdpkklfvprtviiggkaapgyhmakmiikl
    itsvadvvnndpmvgsklkviflenyrvslaekvipatdlseqistagteasgtgnmkfm
    lngaltigtmdganvemaeeageenlfifgmriddvaaldkkgyeakeyyealpelklvi
    dqidngffspkqpdlfkdiinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvl
    kniaasgkfssdrtikeyaqniwnveps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1exvB (B:)
    nvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkrv
    yylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaac
    fldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvhf
    ygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapgdyiqavldrnla
    enisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkafdafpdqvaiqlndthpal
    aipelmrifvdieklpwskaweltqktfaytnhtvlpealerwpvdlvekllprhleiiy
    einqkhldrivalfpkdvdrlrrmslieeegskrinmahlcivgshavngvakihsdivk
    tkvfkdfselepdkfqnktngitprrwlllcnpglaeliaekigedyvkdlsqltklhsf
    lgddvflrelakvkqenklkfsqfleteykvkinpssmfdvqvkriheykrqllnclhvi
    tmynrikkdpkklfvprtviiggkaapgyhmakmiiklitsvadvvnndpmvgsklkvif
    lenyrvslaekvipatdlseqistagteasgtgnmkfmlngaltigtmdganvemaeeag
    eenlfifgmriddvaaldkkgyeakeyyealpelklvidqidngffspkqpdlfkdiinm
    lfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkniaasgkfssdrtikeyaqni
    wnveps