PDB entry 1ext

View 1ext on RCSB PDB site
Description: extracellular domain of the 55kda tumor necrosis factor receptor. crystallized at ph3.7 in p 21 21 21.
Class: signalling protein
Keywords: binding protein, cytokine, signalling protein
Deposited on 1996-07-03, released 1997-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.203
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tumor necrosis factor receptor
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1exta1, d1exta2, d1exta3
  • Chain 'B':
    Compound: tumor necrosis factor receptor
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1extb1, d1extb2, d1extb3, d1extb4
  • Heterogens: SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1extA (A:)
    mdsvcpqgkyihpqnnsicctkchkgtylyndcpgpgqdtdcrecesgsftasenhlrhc
    lscskcrkemgqveissctvdrdtvcgcrknqyrhywsenlfqcfncslclngtvhlscq
    ekqntvctchagfflrenecvscsnckkslectklclpqien
    

    Sequence, based on observed residues (ATOM records): (download)
    >1extA (A:)
    svcpqgkyihpqnnsicctkchkgtylyndcpgpgqdtdcrecesgsftasenhlrhcls
    cskcrkemgqveissctvdrdtvcgcrknqyrhywsenlfqcfncslclngtvhlscqek
    qntvctchagfflrenecvscsnckkslectklclpqien
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1extB (B:)
    mdsvcpqgkyihpqnnsicctkchkgtylyndcpgpgqdtdcrecesgsftasenhlrhc
    lscskcrkemgqveissctvdrdtvcgcrknqyrhywsenlfqcfncslclngtvhlscq
    ekqntvctchagfflrenecvscsnckkslectklclpqien
    

    Sequence, based on observed residues (ATOM records): (download)
    >1extB (B:)
    mdsvcpqgkyihpqnnsicctkchkgtylyndcpgpgqdtdcrecesgsftasenhlrhc
    lscskcrkemgqveissctvdrdtvcgcrknqyrhywsenlfqcfncslclngtvhlscq
    ekqntvctchagfflrenecvscsnckkslectklclp