PDB entry 1exr

View 1exr on RCSB PDB site
Description: the 1.0 angstrom crystal structure of ca+2 bound calmodulin
Deposited on 2000-05-03, released 2000-09-20
The last revision prior to the SCOP 1.55 freeze date was dated 2000-09-20, with a file datestamp of 2000-09-20.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.136
AEROSPACI score: 1.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1exra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1exrA (A:)
    eqlteeqiaefkeafalfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgng
    tidfpeflslmarkmkeqdseeelieafkvfdrdgnglisaaelrhvmtnlgekltddev
    demireadidgdghinyeefvrmmvs