PDB entry 1exp

View 1exp on RCSB PDB site
Description: beta-1,4-glycanase cex-cd
Class: hydrolase
Keywords: cellulose degradation, hydrolase, glycosidase
Deposited on 1996-01-11, released 1997-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.208
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-1,4-d-glycanase cex-cd
    Species: CELLULOMONAS FIMI [TaxId:1708]
    Database cross-references and differences (RAF-indexed):
    • GB AAA56792 (0-311)
    Domains in SCOPe 2.07: d1expa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1expA (A:)
    attlkeaadgagrdfgfaldpnrlseaqykaiadsefnlvvaenamkwdatepsqnsfsf
    gagdrvasyaadtgkelyghtlvwhsqlpdwaknlngsafesamvnhvtkvadhfegkva
    swdvvneafadgggrrqdsafqqklgngyietafraaraadptaklcindynveginaks
    nslydlvkdfkargvpldcvgfqshlivgqvpgdfrqnlqrfadlgvdvriteldirmrt
    psdatklatqaadykkvvqacmqvtrcqgvtvwgitdkyswvpdvfpgegaalvwdasya
    kkpayaavmeaf