PDB entry 1exn

View 1exn on RCSB PDB site
Description: t5 5'-exonuclease
Class: nuclease
Keywords: hydrolase, exonuclease, nuclease
Deposited on 1997-01-17, released 1997-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.227
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-exonuclease
    Species: Enterobacteria phage T5 [TaxId:10726]
    Gene: D15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06229
      • modified residue (21)
      • modified residue (130)
      • modified residue (178)
      • modified residue (197)
    Domains in SCOPe 2.07: d1exna1, d1exna2
  • Chain 'B':
    Compound: 5'-exonuclease
    Species: Enterobacteria phage T5 [TaxId:10726]
    Gene: D15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06229 (Start-289)
      • modified residue (21)
      • modified residue (130)
      • modified residue (178)
      • modified residue (197)
    Domains in SCOPe 2.07: d1exnb1, d1exnb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1exnA (A:)
    skswgkfieeeeaemasrrnlmivdgtnlgfrfkhnnskkpfassyvstiqslaksysar
    ttivlgdkgksvfrlehlpeykgnrdekyaqrteeekaldeqffeylkdafelckttfpt
    ftirgveaddmaayivklighlydhvwlistdgdwdtlltdkvsrfsfttrreyhlrdmy
    ehhnvddveqfislkaimgdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqk
    yiqnlnaseellfrnlilvdlptycvdaiaavgqdvldkftkdileiaeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1exnA (A:)
    rnlmivdgtnlgfrfkhnnskkpfassyvstiqslaksysarttivlgdkgksvfrlehl
    peykgnrdekyaqrteeekaldeqffeylkdafelckttfptftirgveaddmaayivkl
    ighlydhvwlistdgdwdtlltdkvsrfsfttrreyhlrdmyehhnvddveqfislkaim
    gdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqkyiqnlnaseellfrnlil
    vdlptycvdaiaavgqdvldkftkdileiae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1exnB (B:)
    skswgkfieeeeaemasrrnlmivdgtnlgfrfkhnnskkpfassyvstiqslaksysar
    ttivlgdkgksvfrlehlpeykgnrdekyaqrteeekaldeqffeylkdafelckttfpt
    ftirgveaddmaayivklighlydhvwlistdgdwdtlltdkvsrfsfttrreyhlrdmy
    ehhnvddveqfislkaimgdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqk
    yiqnlnaseellfrnlilvdlptycvdaiaavgqdvldkftkdileiaeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1exnB (B:)
    rnlmivdgtnlgfrfkhnnskkpfassyvstiqslaksysarttivlgdkgksvfrlehl
    peykgnrdekyaqrteeekaldeqffeylkdafelckttfptftirgveaddmaayivkl
    ighlydhvwlistdgdwdtlltdkvsrfsfttrreyhlrdmyehhnvddveqfislkaim
    gdlgdnirgvegigakrgyniirefgnvldiidqlplpgkqkyiqnlnaseellfrnlil
    vdlptycvdaiaavgqdvldkftkdileiaeq