PDB entry 1exk

View 1exk on RCSB PDB site
Description: solution structure of the cysteine-rich domain of the escherichia coli chaperone protein dnaj.
Class: chaperone
Keywords: extended beta-hairpin, CXXCXGXG, zinc-binding motif, CHAPERONE
Deposited on 2000-05-03, released 2000-07-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dnaj protein
    Species: Escherichia coli, synthetic [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1exka_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1exkA (A:)
    gvtkeiriptleecdvchgsgakpgtqpqtcptchgsgqvqmrqgffavqqtcphcqgrg
    tlikdpcnkchghgrvers