PDB entry 1exg

View 1exg on RCSB PDB site
Description: solution structure of a cellulose binding domain from cellulomonas fimi by nuclear magnetic resonance spectroscopy
Class: cellulose degradation
Keywords: cellulose binding domain, cellulose degradation
Deposited on 1995-03-14, released 1995-06-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exo-1,4-beta-d-glycanase
    Species: CELLULOMONAS FIMI [TaxId:1708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1exga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1exgA (A:)
    assgpagcqvlwgvnqwntgftanvtvkntssapvdgwtltfsfpsgqqvtqawsstvtq
    sgsavtvrnapwngsipaggtaqfgfngshtgtnaaptafslngtpctvg