PDB entry 1exe

View 1exe on RCSB PDB site
Description: solution structure of a mutant of transcription factor 1.
Class: transcription
Keywords: beta ribbon arms, DNA-binding, DNA-bending protein, TRANSCRIPTION
Deposited on 2000-05-02, released 2000-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription factor 1
    Species: Bacillus phage SPO1 [TaxId:10685]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04445 (0-98)
      • engineered (14)
      • engineered (31)
    Domains in SCOPe 2.07: d1exea_
  • Chain 'B':
    Compound: transcription factor 1
    Species: Bacillus phage SPO1 [TaxId:10685]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04445 (0-98)
      • engineered (14)
      • engineered (31)
    Domains in SCOPe 2.07: d1exeb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1exeA (A:)
    mnktelikaiaqdtgltqvsvskmlasfekiitetvakgdkvqltgflnikpvarqarkg
    fnpqtqealeiapsvgvsvkpgeslkkaaeglkyedfak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1exeB (B:)
    mnktelikaiaqdtgltqvsvskmlasfekiitetvakgdkvqltgflnikpvarqarkg
    fnpqtqealeiapsvgvsvkpgeslkkaaeglkyedfak