PDB entry 1exb

View 1exb on RCSB PDB site
Description: structure of the cytoplasmic beta subunit-t1 assembly of voltage-dependent k channels
Class: metal transport
Keywords: ion channel, oxidoreductase, beta subunit, METAL TRANSPORT
Deposited on 2000-05-02, released 2000-07-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.215
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kv beta2 protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1exba_
  • Chain 'E':
    Compound: potassium channel kv1.1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1exbe_
  • Heterogens: NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1exbA (A:)
    lqfyrnlgksglrvsclglgtwvtfggqitdemaehlmtlaydnginlfdtaevyaagka
    evvlgniikkkgwrrsslvittkifwggkaeterglsrkhiieglkaslerlqleyvdvv
    fanrpdpntpmeetvramthvinqgmamywgtsrwssmeimeaysvarqfnlippiceqa
    eyhmfqrekvevqlpelfhkigvgamtwsplacgivsgkydsgippysraslkgyqwlkd
    kilseegrrqqaklkelqaiaerlgctlpqlaiawclrnegvssvllgasnaeqlmenig
    aiqvlpklsssivheidsilgnkpyskkdyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1exbA (A:)
    lqfyrnlgksglrvsclglgtwvtfggqitdemaehlmtlaydnginlfdtaevyaagka
    evvlgniikkkgwrrsslvittkifwggkaeterglsrkhiieglkaslerlqleyvdvv
    fanrpdpntpmeetvramthvinqgmamywgtsrwssmeimeaysvarqfnlippiceqa
    eyhmfqrekvevqlpelfhkigvgamtwsplacgivsgkydsgippysraslkgyqwlkd
    kilseegrrqqaklkelqaiaerlgctlpqlaiawclrnegvssvllgasnaeqlmenig
    aiqvlpklsssivheidsilgnkpys
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1exbE (E:)
    qadhddheccervvinisglrfetqlktlaqfpntllgnpkkrmryfdplrneyffdrnr
    psfdailyyyqsggrlrrpvnvpldmfseeikfyelgeeamek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1exbE (E:)
    cervvinisglrfetqlktlaqfpntllgnpkkrmryfdplrneyffdrnrpsfdailyy
    yqsggrlrrpvnvpldmfseeikfyelgeea