PDB entry 1exa

View 1exa on RCSB PDB site
Description: enantiomer discrimination illustrated by crystal structures of the human retinoic acid receptor hrargamma ligand binding domain: the complex with the active r-enantiomer bms270394.
Deposited on 2000-05-02, released 2000-06-09
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-09, with a file datestamp of 2000-06-09.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.209
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1exaa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1exaA (A:)
    lspqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciiki
    vefakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhn
    agfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqeplleal
    rlyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremle