PDB entry 1exa

View 1exa on RCSB PDB site
Description: enantiomer discrimination illustrated by crystal structures of the human retinoic acid receptor hrargamma ligand binding domain: the complex with the active r-enantiomer bms270394.
Class: gene regulation
Keywords: enantiomer discrimination, retinoid ligand complexes, antiparallel alpha-helical sandwich fold, Structural Proteomics in Europe, SPINE, Structural Genomics, GENE REGULATION
Deposited on 2000-05-02, released 2000-06-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.209
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: retinoic acid receptor gamma-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1exaa_
  • Heterogens: 394, LMU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1exaA (A:)
    dsyelspqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkc
    iikivefakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrt
    qmhnagfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqepl
    lealrlyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremle
    npemfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1exaA (A:)
    lspqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciiki
    vefakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhn
    agfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqeplleal
    rlyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremle