PDB entry 1ex9

View 1ex9 on RCSB PDB site
Description: crystal structure of the pseudomonas aeruginosa lipase complexed with rc-(rp,sp)-1,2-dioctylcarbamoyl-glycero-3-o-octylphosphonate
Class: hydrolase
Keywords: Lipase, alpha-beta hydrolase fold, Pseudomonas, phosphonate inhibitor
Deposited on 2000-05-02, released 2000-10-18
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: 0.195
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactonizing lipase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ex9a_
  • Heterogens: CA, OCP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ex9A (A:)
stytqtkypivlahgmlgfdnilgvdywfgipsalrrdgaqvyvtevsqldtsevrgeql
lqqveeivalsgqpkvnlighshggptiryvaavrpdliasatsvgaphkgsdtadflrq
ippgsageavlsglvnslgalisflssgstgtqnslgsleslnsegaarfnakypqgipt
sacgegaykvngvsyyswsgsspltnfldpsdaflgassltfkngtandglvgtcsshlg
mvirdnyrmnhldevnqvfgltslfetspvsvyrqhanrlknasl