PDB entry 1ex8

View 1ex8 on RCSB PDB site
Description: crystal structure of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with hp4a, the two-substrate-mimicking inhibitor
Class: transferase
Keywords: pyrophosphokinase, pyrophosphoryl transfer, folate, hppk, pterin, ATP, bisubstrate-mimicking inhibitor, antimicrobial agent, drug design, substrate specificity, active-site architecture, x-ray crystallography, transferase
Deposited on 2000-05-01, released 2001-05-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.211
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ex8a_
  • Heterogens: MG, CL, A4P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ex8A (A:)
    tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
    etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
    rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw