PDB entry 1ex4

View 1ex4 on RCSB PDB site
Description: hiv-1 integrase catalytic core and c-terminal domain
Deposited on 2000-04-28, released 2000-06-07
The last revision prior to the SCOP 1.55 freeze date was dated 2000-07-26, with a file datestamp of 2000-07-26.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.258
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ex4A (A:)
    sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktiht
    dngsnftgatvraacdwagikqedgipynpqsqgvvesmnkelkkiigqvrdqaehlkta
    vqmavfihnkkrkggiggysagerivdiiatdiqtkelqkqitkiqnfrvyyrdsrnslw
    kgpakllwkgegavviqdnsdikvvprrkakiird
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ex4A (A:)
    sspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktiht
    dngsnftgatvraacdwagikqedgipqsqgvvesmnkelkkiigqvrdqaehlktavqm
    avfihnkkrkggiggysagerivdiiatdiqtkelqkqitkiqnfrvyyrdsrnslwkgp
    akllwkgegavviqdnsdikvvprrkakiird
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ex4B (B:)
    dsspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktih
    tdngsnftgatvraacdwagikqedgipynpqsqgvvesmnkelkkiigqvrdqaehlkt
    avqmavfihnkkrkggiggysagerivdiiatdiqtkelqkqitkiqnfrvyyrdsrnsl
    wkgpakllwkgegavviqdnsdikvvprrkakiird
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ex4B (B:)
    dsspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktih
    tdngsnftgatvraacdwagikqvvesmnkelkkiigqvrdqaehlktavqmavfihnkk
    rkggiggysagerivdiiatdiqtkelqkqitkiqnfrvyyrdsrnslwkgpakllwkge
    gavviqdnsdikvvprrkakiird