PDB entry 1ex3

View 1ex3 on RCSB PDB site
Description: crystal structure of bovine chymotrypsinogen a (tetragonal)
Deposited on 2000-04-28, released 2000-05-17
The last revision prior to the SCOP 1.55 freeze date was dated 2000-08-30, with a file datestamp of 2000-08-30.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.204
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1ex3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ex3A (A:)
    cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan