PDB entry 1ewy

View 1ewy on RCSB PDB site
Description: anabaena pcc7119 ferredoxin:ferredoxin-nadp+-reductase complex
Class: oxidoreductase
Keywords: electron transfer complex, photosynthesis, protein-protein interaction, ferredoxin, reductase, oxidoreductase
Deposited on 2000-04-28, released 2001-02-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.219
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin-nadp reductase
    Species: NOSTOC SP. PCC 7119 [TaxId:1168]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ewya1, d1ewya2
  • Chain 'B':
    Compound: ferredoxin-nadp reductase
    Species: NOSTOC SP. PCC 7119 [TaxId:1168]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ewyb1, d1ewyb2
  • Chain 'C':
    Compound: ferredoxin I
    Species: NOSTOC SP. PCC 7119 [TaxId:1168]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ewyc_
  • Heterogens: FAD, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ewyA (A:)
    tqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsi
    giippgvdkngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcsty
    lthiepgsevkitgpvgkemllpddpeanvimlatgtgiapmrtylwrmfkdaeraanpe
    yqfkgfswlvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrv
    aehadelwqliknqkthtyicglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhv
    ety
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ewyB (B:)
    tqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsi
    giippgvdkngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcsty
    lthiepgsevkitgpvgkemllpddpeanvimlatgtgiapmrtylwrmfkdaeraanpe
    yqfkgfswlvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrv
    aehadelwqliknqkthtyicglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhv
    ety
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ewyC (C:)
    atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
    sdqsfldddqieagyvltcvayptsdvviqthkeedly